PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vocar.0015s0269.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Volvox
Family CO-like
Protein Properties Length: 1356aa    MW: 138372 Da    PI: 6.4434
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vocar.0015s0269.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.25.9e-07839435
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHk 35
                          +C++++ k ++ fC++++ +lC++C  + H+
  Vocar.0015s0269.1.p  8 VVCDHCDAKLASVFCHSDGAFLCPQCDAQVHS 39
                         68**************************9993 PP

2CCT37.11.1e-138989241844
                  CCT  18 eKkirYesRKavAesRpRvKGrFvkqa 44 
                           Kk+rYe+RK++A++RpRv+GrF+k +
  Vocar.0015s0269.1.p 898 AKKVRYECRKQMADTRPRVRGRFAKVN 924
                          59**********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.0E-8552IPR000315B-box-type zinc finger
PROSITE profilePS5011910.751552IPR000315B-box-type zinc finger
PfamPF006431.9E-5750IPR000315B-box-type zinc finger
CDDcd000211.24E-8851No hitNo description
PROSITE profilePS5101711.052881923IPR010402CCT domain
PfamPF062034.1E-11884923IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1356 aa     Download sequence    Send to blast
MDSSNFKVVC DHCDAKLASV FCHSDGAFLC PQCDAQVHSV NKLAQRHLRV PCQSCPVWAY  60
REAKSRGRLL DMPLAACLTK NLHLDVFDGA SACWPSKNAS SVAMGTPQSD ASSPQATTAA  120
PLVNAGSPNS EVHATAFHQP SNSWSQNSAL AMVTSQPQPM PQPSLGCLSM SQGMEPAEGA  180
RAAAALFSIS PFSACSGGSL QAAANAAVQR PPQPGPERCS VQGVQASTTT TTAAATAAPP  240
PPQQQQQHIS QAAQSQHSQH TLQRAASQEL MDAVDSMDVA MLLDTFGAPL DQLQDNSNKR  300
NGDAVQQQQQ QQQSQVLPQQ ESSAQQQQFM AATQQQQQIV AAELLQSQAS AMCMTSMPSA  360
AVAATGGAAA AAGAPATLGN TLNMSSVWAP LAHQAQVQQQ QQQQHTLFQQ QQQLLQEQLQ  420
QQQRQVQVNA AAIAAAAAGC LAQPSAFAVQ LSEPMAVPTQ QRQQITTARS LSGLSCLSQS  480
GLSSNNTDGQ QLGSARSSNT LLLQSLDQQM TGMATCGLPM MTVAGPMAPT SGGGGGAGVG  540
AAAAGWASIE ATQRQLQQLQ QQQQQTALQY LQQKQQQQQV AAALAAAQQQ QQQQKQAMQQ  600
LLQRAMTEDL PRTSPISIGT AAGGVTAFAS ARRDATVRGG LGLLDPGIGR GRSLAQSPMS  660
LLPVPGTAFA SSSCSLLDNL SGSGMNPSSI AAVAAAAAGR VAPGNPFGVG LLPGAAPGGP  720
TAAMAAAAAA APQPLPGARS LDAAAASSFG ALPTSVVGSG GSTSVSPSNC NTLAGAVAER  780
HVPLTAQQLA QQMVLPGSAP PALGLAASVT MGSCDLSESH LMRMSSDGFD GLIGAAATVT  840
GNSLGNSLGM LGLDSDAAGL LTLLERPDGT LKELDPERAA QLNRQKRMLR MRALAEGAKK  900
VRYECRKQMA DTRPRVRGRF AKVNSSDTLL EFGSAACLPA SSSGNNATTT GSVASASACT  960
APAGVAFHGP GGSGGSGGGG GGGWGLHGHH AHAAPQPHMQ RIDEEGISEG QSPLVLPTAG  1020
SFPMRQASSS SQEAGTGPGP AGGAATSEGA TATATEAAAA AAAGALGAVC GFTSAMITDQ  1080
ARVEPQQQQQ QLLLQDCSQR LQRAQSSSMA DVARMVDSMQ TGLLGSCNNT ANTCSTTVIA  1140
TGAAAAAQGG LGAAGHDCDI TEHDLAALGF DELPQLSGGL SNGGHSMNED MDESAESMND  1200
GVSTMPDCVP VPGARPPSVL QPSGQVVVMQ HTTGVQNPSG ALQPPPSSAA LPQHQHQHQL  1260
QVLGPQQLLA APQSLPAIAS ACFLQQAQHQ HIQTQPLAPP PPQQQLQPRL SVLDRPIMYG  1320
TDRSQFSAAQ LSLLDSILTD QYRPSSGGAA AIGRH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002946907.10.0hypothetical protein VOLCADRAFT_86975
TrEMBLD8TJU70.0D8TJU7_VOLCA; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-11CONSTANS-like 1